Skip to Content

Amyloid Betasize:Peptide 1size:42 human size:size:> C203H311N55O60S1 NH2size:DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIAsize:COOH Purity: 95% size: 10x1mg

https://bio.gentaur.us/web/image/product.template/4846/image_1920?unique=150d2ef
(0 review)

930.00 € 930.0 EUR 930.00 € Tax Excluded

930.00 € Tax Excluded

Not Available For Sale

(0.00 € / Units)

This combination does not exist.

This content will be shared across all product pages.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: 0399-CSB-DT1442-10x1mg
Website URL: /shop/0399-csb-dt1442-10x1mg-amyloid-betasize-peptide-1size-42-human-size-size-c203h311n55o60s1-nh2size-daefrhdsgyevhhqklvffaedvgsnkgaiiglmvggvviasize-cooh-purity-95-size-10x1mg-4846
Display Name: [0399-CSB-DT1442-10x1mg] Amyloid Betasize:Peptide 1size:42 human size:size:> C203H311N55O60S1 NH2size:DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIAsize:COOH Purity: 95% size: 10x1mg

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provided both a filter and a template to use.